PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02275.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 333aa    MW: 37416.7 Da    PI: 8.5428
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02275.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.62.5e-49141391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrF Ptdeel+v+yL++k++g++++l + i+e+d+yk++ w Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkat
  Rsa1.0_02275.1_g00001.1  14 LPPGFRFYPTDEELMVDYLCRKAAGHDFSL-QLIAEIDLYKFDAWVLPSKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKAT 98 
                              79***************************9.89***************8777899******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk + + +g+ vg+kk Lvfy g+apkg+kt+W+mheyrl
  Rsa1.0_02275.1_g00001.1  99 GTDKVIST-EGRRVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                              ***99999.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-6410162IPR003441NAC domain
PROSITE profilePS5100558.07214162IPR003441NAC domain
PfamPF023653.6E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGIQELDPLA QLSLPPGFRF YPTDEELMVD YLCRKAAGHD FSLQLIAEID LYKFDAWVLP  60
SKALFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVISTEGRR VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLI EPSRRNGSTK LDDWVLCRIY KKQSSAQRQA YGNLMTTTSE  180
YSNNGSSTST SSHHYDDVLE SLHEIDNRSL GYAAGSSNAV PHYSHRPALT EQKTGFLNLA  240
REPSYDWTNF GGHNTVPELR RSHNVPSLRY GDGGGYLHGV KTNEEEDKTK QQHAEGIPRF  300
NNSGVLAPDQ GFHVDPVNGF GYSGQQPGGF GFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-11811684171NO APICAL MERISTEM PROTEIN
1ut4_B1e-11811684171NO APICAL MERISTEM PROTEIN
1ut7_A1e-11811684171NO APICAL MERISTEM PROTEIN
1ut7_B1e-11811684171NO APICAL MERISTEM PROTEIN
3swm_A1e-11811687174NAC domain-containing protein 19
3swm_B1e-11811687174NAC domain-containing protein 19
3swm_C1e-11811687174NAC domain-containing protein 19
3swm_D1e-11811687174NAC domain-containing protein 19
3swp_A1e-11811687174NAC domain-containing protein 19
3swp_B1e-11811687174NAC domain-containing protein 19
3swp_C1e-11811687174NAC domain-containing protein 19
3swp_D1e-11811687174NAC domain-containing protein 19
4dul_A1e-11811684171NAC domain-containing protein 19
4dul_B1e-11811684171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00360DAPTransfer from AT3G15500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6701210.0KJ670121.1 Brassica napus NAC transcription factor 55-1 (NAC55-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638893.10.0PREDICTED: NAC domain-containing protein 55
SwissprotQ9LDY80.0NAC55_ARATH; NAC domain-containing protein 55
TrEMBLA0A0D3CJW30.0A0A0D3CJW3_BRAOL; Uncharacterized protein
STRINGBra027238.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14352795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.10.0NAC domain containing protein 3